Lineage for d3d85a2 (3d85 A:108-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2749973Domain d3d85a2: 3d85 A:108-213 [199227]
    Other proteins in same PDB: d3d85a1, d3d85b_, d3d85d1, d3d85d2, d3d85d3
    automated match to d1rhha2
    complexed with imd, mpd

Details for d3d85a2

PDB Entry: 3d85 (more details), 1.9 Å

PDB Description: crystal structure of il-23 in complex with neutralizing fab
PDB Compounds: (A:) FAB of antibody 7G10, light chain

SCOPe Domain Sequences for d3d85a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d85a2 b.1.1.2 (A:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d3d85a2:

Click to download the PDB-style file with coordinates for d3d85a2.
(The format of our PDB-style files is described here.)

Timeline for d3d85a2: