PDB entry 3d85

View 3d85 on RCSB PDB site
Description: Crystal structure of IL-23 in complex with neutralizing FAB
Class: immune system/cytokine
Keywords: Interleukin-23, FAB, IMMUNE SYSTEM/CYTOKINE COMPLEX
Deposited on 2008-05-22, released 2008-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-12-23, with a file datestamp of 2009-02-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.172
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FAB of antibody 7G10, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3D85 (0-End)
    Domains in SCOPe 2.07: d3d85a1, d3d85a2
  • Chain 'B':
    Compound: FAB of antibody 7G10, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3D85 (0-End)
  • Chain 'C':
    Compound: Interleukin-23 subunit p19
    Species: Homo sapiens [TaxId:9606]
    Gene: IL23A, SGRF, UNQ2498/PRO5798
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Interleukin-12 subunit p40
    Species: Homo sapiens [TaxId:9606]
    Gene: IL12B, NKSF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29460 (0-End)
      • engineered (199)
    Domains in SCOPe 2.07: d3d85d1, d3d85d2, d3d85d3
  • Heterogens: IMD, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d85A (A:)
    divmtqspatlsvtpgdrvslscrasqsisdylhwyrqkshesprllikyasqsisgips
    rfsgsgsgsdftlsinsvepedvgvyycqnghsfpftfgsgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d85A (A:)
    divmtqspatlsvtpgdrvslscrasqsisdylhwyrqkshesprllikyasqsisgips
    rfsgsgsgsdftlsinsvepedvgvyycqnghsfpftfgsgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3d85D (D:)
    iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef
    gdagqytchkggevlshsllllhkkedgiwstdilkdqkepknktflrceaknysgrftc
    wwlttistdltfsvkssrgssdpqgvtcgaatlsaervrgdnkeyeysvecqedsacpaa
    eeslpievmvdavhklkyeqytssffirdiikpdppknlqlkplknsrqvevsweypdtw
    stphsyfsltfcvqvqgkskrekkdrvftdktsatvicrknasisvraqdryyssswsew
    asvpcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d85D (D:)
    iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef
    gdagqytchkggevlshsllllhkkedgiwstdilkdqknktflrceaknysgrftcwwl
    ttistdltfsvkssrgssdpqgvtcgaatlsaervrnkeyeysvecqedsacpaaeeslp
    ievmvdavhklkyeqytssffirdiikpdppknlqlkplqvevsweypdtwstphsyfsl
    tfcvqvqgkdrvftdktsatvicrknasisvraqdryyssswsewasvpc