Lineage for d3c7la_ (3c7l A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496843Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 1496844Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 1496845Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)
  6. 1496870Protein Regulator of G-protein signaling 16, RGS16 [158689] (2 species)
  7. 1496874Species Mouse (Mus musculus) [TaxId:10090] [188430] (2 PDB entries)
  8. 1496875Domain d3c7la_: 3c7l A: [199174]
    automated match to d3c7lb_

Details for d3c7la_

PDB Entry: 3c7l (more details), 1.89 Å

PDB Description: molecular architecture of galphao and the structural basis for rgs16- mediated deactivation
PDB Compounds: (A:) Regulator of G-protein signaling 16

SCOPe Domain Sequences for d3c7la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c7la_ a.91.1.1 (A:) Regulator of G-protein signaling 16, RGS16 {Mouse (Mus musculus) [TaxId: 10090]}
dvlgwresfdlllnskngvaafhaflktefseenlefwlaceefkkirsatklasrahhi
fdeyirseapkevnidhetreltktnlqaattscfdvaqgktrtlmekdsyprflkspay
rdla

SCOPe Domain Coordinates for d3c7la_:

Click to download the PDB-style file with coordinates for d3c7la_.
(The format of our PDB-style files is described here.)

Timeline for d3c7la_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3c7lb_