SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3c7la_ (3c7l A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002317Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2002318Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2002319Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 protein domains)
  6. 2002344Protein Regulator of G-protein signaling 16, RGS16 [158689] (2 species)
  7. 2002348Species Mouse (Mus musculus) [TaxId:10090] [188430] (2 PDB entries)
  8. 2002349Domain d3c7la_: 3c7l A: [199174]
    automated match to d3c7lb_

Details for d3c7la_

PDB Entry: 3c7l (more details), 1.89 Å

PDB Description: Molecular architecture of Galphao and the structural basis for RGS16-mediated deactivation
PDB Compounds: (A:) Regulator of G-protein signaling 16

SCOPe Domain Sequences for d3c7la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c7la_ a.91.1.1 (A:) Regulator of G-protein signaling 16, RGS16 {Mouse (Mus musculus) [TaxId: 10090]}
dvlgwresfdlllnskngvaafhaflktefseenlefwlaceefkkirsatklasrahhi
fdeyirseapkevnidhetreltktnlqaattscfdvaqgktrtlmekdsyprflkspay
rdla

SCOPe Domain Coordinates for d3c7la_:

Click to download the PDB-style file with coordinates for d3c7la_.
(The format of our PDB-style files is described here.)

Timeline for d3c7la_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3c7lb_