Lineage for d3c15c1 (3c15 C:36-66,C:202-388)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1595281Protein Transducin (alpha subunit) [52623] (4 species)
    common fold is interrupted with an all-alpha domain
  7. 1595282Species Cow (Bos taurus) [TaxId:9913] [52624] (18 PDB entries)
    Uniprot P04896 39-388
  8. 1595300Domain d3c15c1: 3c15 C:36-66,C:202-388 [199148]
    Other proteins in same PDB: d3c15a_, d3c15b_, d3c15c2
    automated match to d1azsc2
    complexed with cl, fok, gsp, mg, pop

Details for d3c15c1

PDB Entry: 3c15 (more details), 2.78 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with pyrophosphate and mg
PDB Compounds: (C:) Guanine nucleotide-binding protein G(s) subunit alpha isoforms short

SCOPe Domain Sequences for d3c15c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c15c1 c.37.1.8 (C:36-66,C:202-388) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}
vyrathrllllgagesgkstivkqmrilhvnXvltsgifetkfqvdkvnfhmfdvggqrd
errkwiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvil
flnkqdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflris
tasgdgrhycyphftcavdtenirrvfndcrdiiqrmhl

SCOPe Domain Coordinates for d3c15c1:

Click to download the PDB-style file with coordinates for d3c15c1.
(The format of our PDB-style files is described here.)

Timeline for d3c15c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3c15c2