Lineage for d3bued_ (3bue D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564740Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2564803Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families) (S)
    forms trimers with three closely packed beta-sheets
  5. 2564845Family d.74.2.0: automated matches [194896] (1 protein)
    not a true family
  6. 2564846Protein automated matches [194897] (4 species)
    not a true protein
  7. 2564857Species Mycobacterium tuberculosis [TaxId:83332] [194898] (3 PDB entries)
  8. 2564861Domain d3bued_: 3bue D: [199119]
    automated match to d3buef_

Details for d3bued_

PDB Entry: 3bue (more details), 2.15 Å

PDB Description: Crystal structure of the C-terminal domain hexamer of ArgR from Mycobacterium tuberculosis
PDB Compounds: (D:) Arginine repressor ArgR

SCOPe Domain Sequences for d3bued_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bued_ d.74.2.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ggtdrmarllgellvstddsgnlavlrtppgaahylasaidraalpqvvgtiagddtilv
varepttgaqlagmfenlr

SCOPe Domain Coordinates for d3bued_:

Click to download the PDB-style file with coordinates for d3bued_.
(The format of our PDB-style files is described here.)

Timeline for d3bued_: