Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families) forms trimers with three closely packed beta-sheets |
Family d.74.2.0: automated matches [194896] (1 protein) not a true family |
Protein automated matches [194897] (4 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [194898] (3 PDB entries) |
Domain d3bued_: 3bue D: [199119] automated match to d3buef_ |
PDB Entry: 3bue (more details), 2.15 Å
SCOPe Domain Sequences for d3bued_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bued_ d.74.2.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} ggtdrmarllgellvstddsgnlavlrtppgaahylasaidraalpqvvgtiagddtilv varepttgaqlagmfenlr
Timeline for d3bued_: