Lineage for d3bdwb_ (3bdw B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2607280Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2607740Protein automated matches [190329] (10 species)
    not a true protein
  7. 2607761Species Human (Homo sapiens) [TaxId:9606] [187151] (9 PDB entries)
  8. 2607787Domain d3bdwb_: 3bdw B: [199086]
    Other proteins in same PDB: d3bdwa_, d3bdwc_
    automated match to d1fm5a_

Details for d3bdwb_

PDB Entry: 3bdw (more details), 2.5 Å

PDB Description: human cd94/nkg2a
PDB Compounds: (B:) NKG2-A/NKG2-B type II integral membrane protein

SCOPe Domain Sequences for d3bdwb_:

Sequence, based on SEQRES records: (download)

>d3bdwb_ d.169.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
arhcghcpeewitysnscyyigkerrtweesllactsknssllsidneeemkflsiisps
swigvfrnsshhpwvtmnglafkheikdsdnaelncavlqvnrlksaqcgssiiyhckhk

Sequence, based on observed residues (ATOM records): (download)

>d3bdwb_ d.169.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
arhcghcpeewitysnscyyigkerrtweesllactsknssllsidneeemkflsiisps
swigvfrnsshhpwvtmnglafkheikaelncavlqvnrlksaqcgssiiyhckhk

SCOPe Domain Coordinates for d3bdwb_:

Click to download the PDB-style file with coordinates for d3bdwb_.
(The format of our PDB-style files is described here.)

Timeline for d3bdwb_: