![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
![]() | Protein automated matches [190329] (10 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187151] (10 PDB entries) |
![]() | Domain d3bdwb_: 3bdw B: [199086] Other proteins in same PDB: d3bdwa_, d3bdwc_ automated match to d1fm5a_ |
PDB Entry: 3bdw (more details), 2.5 Å
SCOPe Domain Sequences for d3bdwb_:
Sequence, based on SEQRES records: (download)
>d3bdwb_ d.169.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} arhcghcpeewitysnscyyigkerrtweesllactsknssllsidneeemkflsiisps swigvfrnsshhpwvtmnglafkheikdsdnaelncavlqvnrlksaqcgssiiyhckhk
>d3bdwb_ d.169.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} arhcghcpeewitysnscyyigkerrtweesllactsknssllsidneeemkflsiisps swigvfrnsshhpwvtmnglafkheikaelncavlqvnrlksaqcgssiiyhckhk
Timeline for d3bdwb_: