SCOPe 2.07: Domain d4fabh1: 4fab H:1-118

Lineage for d4fabh1 (4fab H:1-118)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (68 PDB entries)
   Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4

8. Domain d4fabh1: 4fab H:1-118 [19907]
   Other proteins in same PDB: d4fabh2, d4fabl1, d4fabl2
   part of Fab 4-4-20
   complexed with flu, mpd

Details for d4fabh1

PDB Entry: 4fab, 2.7 Å

PDB Description: three-dimensional structure of a fluorescein-fab complex crystallized in 2-methyl-2,4-pentanediol

PDB Compounds: (H:) igg2a-kappa 4-4-20 fab (heavy chain)

SCOPe Domain Sequences for d4fabh1:

Sequence; same for both SEQRES and ATOM records:

>d4fabh1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evkldetggglvqpgrpmklscvasgftfsdywmnwvrqspekglewvaqirnkpynyet
yysdsvkgrftisrddskssvylqmnnlrvedmgiyyctgsyygmdywgqgtsvtvss

Timeline for d4fabh1:

• d4fabh1 first appeared (with stable ids) in SCOP 1.55
  
• d4fabh1 appears in SCOPe 2.06
  
• d4fabh1 appears in the current release, SCOPe 2.08