Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.23: FAD-linked oxidoreductase [51730] (3 families) distinct cofactor-binding mode from both FMN- and NAD(P)-linked TIM-barrel oxidoreductases; families are related by a circular permutation |
Family c.1.23.1: Methylenetetrahydrofolate reductase [51731] (2 proteins) automatically mapped to Pfam PF02219 |
Protein automated matches [193645] (4 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [193648] (2 PDB entries) |
Domain d3apta_: 3apt A: [198905] automated match to d3aptb_ complexed with act, fad |
PDB Entry: 3apt (more details), 1.85 Å
SCOPe Domain Sequences for d3apta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3apta_ c.1.23.1 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mkirdllkarrgplfsfeffppkdpegeealfrtleelkafrpafvsitygamgstrers vawaqriqslglnplahltvagqsrkevaevlhrfvesgvenllalrgdpprgervfrph pegfryaaelvalirerygdrvsvggaaypeghpesesleadlrhfkakveagldfaitq lffnnahyfgflerarragigipilpgimpvtsyrqlrrftevcgasipgpllaklerhq ddpkavleigvehavrqvaelleagvegvhfytlnkspatrmvlerlglrpa
Timeline for d3apta_: