SCOPe 2.08: Domain d3apta_: 3apt A:

Lineage for d3apta_ (3apt A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.23: FAD-linked oxidoreductase [51730] (3 families)
   distinct cofactor-binding mode from both FMN- and NAD(P)-linked TIM-barrel oxidoreductases; families are related by a circular permutation

5. Family c.1.23.1: Methylenetetrahydrofolate reductase [51731] (2 proteins)
   automatically mapped to Pfam PF02219

6. Protein automated matches [193645] (4 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [193648] (2 PDB entries)

8. Domain d3apta_: 3apt A: [198905]
   automated match to d3aptb_
   complexed with act, fad

Details for d3apta_

PDB Entry: 3apt, 1.85 Å

PDB Description: properties and crystal structure of methylenetetrahydrofolate reductase from Thermus thermophilus HB8

PDB Compounds: (A:) Methylenetetrahydrofolate reductase

SCOPe Domain Sequences for d3apta_:

Sequence; same for both SEQRES and ATOM records:

>d3apta_ c.1.23.1 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mkirdllkarrgplfsfeffppkdpegeealfrtleelkafrpafvsitygamgstrers
vawaqriqslglnplahltvagqsrkevaevlhrfvesgvenllalrgdpprgervfrph
pegfryaaelvalirerygdrvsvggaaypeghpesesleadlrhfkakveagldfaitq
lffnnahyfgflerarragigipilpgimpvtsyrqlrrftevcgasipgpllaklerhq
ddpkavleigvehavrqvaelleagvegvhfytlnkspatrmvlerlglrpa

Timeline for d3apta_:

• d3apta_ first appeared in SCOPe 2.03
  
• d3apta_ appears in SCOPe 2.07