Lineage for d3akmb_ (3akm B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2414378Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2414619Protein Intestinal fatty acid binding protein [50851] (2 species)
  7. 2414620Species Human (Homo sapiens) [TaxId:9606] [50853] (7 PDB entries)
  8. 2414622Domain d3akmb_: 3akm B: [198898]
    automated match to d1kzwa_
    complexed with 11d, mg

Details for d3akmb_

PDB Entry: 3akm (more details), 1.9 Å

PDB Description: X-ray structure of iFABP from human and rat with bound fluorescent fatty acid analogue
PDB Compounds: (B:) Fatty acid-binding protein, intestinal

SCOPe Domain Sequences for d3akmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3akmb_ b.60.1.2 (B:) Intestinal fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]}
afdstwkvdrsenydkfmekmgvnivkrklaahdnlkltitqegnkftvkessafrniev
vfelgvtfnynladgtelrgtwslegnkligkfkrtdngnelntvreiigdelvqtyvye
gveakrifkkd

SCOPe Domain Coordinates for d3akmb_:

Click to download the PDB-style file with coordinates for d3akmb_.
(The format of our PDB-style files is described here.)

Timeline for d3akmb_: