Class b: All beta proteins [48724] (177 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein Intestinal fatty acid binding protein [50851] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50853] (6 PDB entries) |
Domain d3akmb_: 3akm B: [198898] automated match to d1kzwa_ complexed with 11d, mg |
PDB Entry: 3akm (more details), 1.9 Å
SCOPe Domain Sequences for d3akmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3akmb_ b.60.1.2 (B:) Intestinal fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]} afdstwkvdrsenydkfmekmgvnivkrklaahdnlkltitqegnkftvkessafrniev vfelgvtfnynladgtelrgtwslegnkligkfkrtdngnelntvreiigdelvqtyvye gveakrifkkd
Timeline for d3akmb_: