![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
![]() | Protein automated matches [226905] (11 species) not a true protein |
![]() | Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [226007] (4 PDB entries) |
![]() | Domain d3a5nc2: 3a5n C:147-375 [198834] Other proteins in same PDB: d3a5nc1, d3a5ns_ automated match to d1d4xa2 complexed with atp, ca |
PDB Entry: 3a5n (more details), 2.36 Å
SCOPe Domain Sequences for d3a5nc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a5nc2 c.55.1.1 (C:147-375) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} rttgivmdsgdgvshtvpiyegyalphailrldlagrdltdymmkiltergysftttaaa aivrdikeklayvaldfeaemqtaasssaleksyelpdgqvitignerfrcpealfqpsf lgmesagihettynsimkcdvdirkdlygnvvlsggttmfpgiadrmnkeltalapstmk ikiiapperkysvwiggsilaslstfqqmwiskeeydesgpsivhrkcf
Timeline for d3a5nc2: