Lineage for d3a5lc2 (3a5l C:147-375)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1372366Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1372729Protein automated matches [226905] (10 species)
    not a true protein
  7. 1372821Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [226007] (4 PDB entries)
  8. 1372825Domain d3a5lc2: 3a5l C:147-375 [198830]
    Other proteins in same PDB: d3a5lc1, d3a5ls_
    automated match to d1d4xa2
    complexed with adp, ca, mg

Details for d3a5lc2

PDB Entry: 3a5l (more details), 2.4 Å

PDB Description: Crystal Structure of a Dictyostelium P109A Mg2+-Actin in Complex with Human Gelsolin Segment 1
PDB Compounds: (C:) Major actin

SCOPe Domain Sequences for d3a5lc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a5lc2 c.55.1.1 (C:147-375) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
rttgivmdsgdgvshtvpiyegyalphailrldlagrdltdymmkiltergysftttaaa
aivrdikeklayvaldfeaemqtaasssaleksyelpdgqvitignerfrcpealfqpsf
lgmesagihettynsimkcdvdirkdlygnvvlsggttmfpgiadrmnkeltalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskeeydesgpsivhrkcf

SCOPe Domain Coordinates for d3a5lc2:

Click to download the PDB-style file with coordinates for d3a5lc2.
(The format of our PDB-style files is described here.)

Timeline for d3a5lc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3a5lc1
View in 3D
Domains from other chains:
(mouse over for more information)
d3a5ls_