SCOPe 2.03: Domain d3a5lc2: 3a5l C:147-375

Lineage for d3a5lc2 (3a5l C:147-375)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (10 species)
   not a true protein

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [226007] (4 PDB entries)

8. Domain d3a5lc2: 3a5l C:147-375 [198830]
   Other proteins in same PDB: d3a5lc1, d3a5ls_
   automated match to d1d4xa2
   complexed with adp, ca, mg

Details for d3a5lc2

PDB Entry: 3a5l, 2.4 Å

PDB Description: Crystal Structure of a Dictyostelium P109A Mg2+-Actin in Complex with Human Gelsolin Segment 1

PDB Compounds: (C:) Major actin

SCOPe Domain Sequences for d3a5lc2:

Sequence; same for both SEQRES and ATOM records:

>d3a5lc2 c.55.1.1 (C:147-375) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
rttgivmdsgdgvshtvpiyegyalphailrldlagrdltdymmkiltergysftttaaa
aivrdikeklayvaldfeaemqtaasssaleksyelpdgqvitignerfrcpealfqpsf
lgmesagihettynsimkcdvdirkdlygnvvlsggttmfpgiadrmnkeltalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskeeydesgpsivhrkcf

Timeline for d3a5lc2:

• d3a5lc2 is new in SCOPe 2.03-stable
  
• d3a5lc2 appears in SCOPe 2.04
  
• d3a5lc2 appears in the current release, SCOPe 2.08