Lineage for d3a5ls_ (3a5l S:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1427557Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1427558Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 1427559Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 1427560Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 1427577Species Human (Homo sapiens) [TaxId:9606] [55761] (30 PDB entries)
    Uniprot P20065 55-179
  8. 1427614Domain d3a5ls_: 3a5l S: [171754]
    Other proteins in same PDB: d3a5lc1, d3a5lc2
    automated match to d1c0fs_
    complexed with adp, ca, mg

Details for d3a5ls_

PDB Entry: 3a5l (more details), 2.4 Å

PDB Description: Crystal Structure of a Dictyostelium P109A Mg2+-Actin in Complex with Human Gelsolin Segment 1
PDB Compounds: (S:) gelsolin

SCOPe Domain Sequences for d3a5ls_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a5ls_ d.109.1.1 (S:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
vehpeflkagkepglqiwrvekfdlvpvptclygdfftgdayvilktvqlrngnlqydlh
ywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggva
sgf

SCOPe Domain Coordinates for d3a5ls_:

Click to download the PDB-style file with coordinates for d3a5ls_.
(The format of our PDB-style files is described here.)

Timeline for d3a5ls_: