![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
![]() | Family d.109.1.1: Gelsolin-like [55754] (5 proteins) |
![]() | Protein Gelsolin [55759] (2 species) consists of six similar domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55761] (30 PDB entries) Uniprot P20065 55-179 |
![]() | Domain d1c0fs_: 1c0f S: [40851] Other proteins in same PDB: d1c0fa1, d1c0fa2 domain 1 complexed with atp, ca |
PDB Entry: 1c0f (more details), 2.4 Å
SCOPe Domain Sequences for d1c0fs_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c0fs_ d.109.1.1 (S:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} mgsvvehpeflkagkepglqiwrvekfdlvpvptclygdfftgdayvilktvqlrngnlq ydlhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykk ggvasgf
Timeline for d1c0fs_: