| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
| Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
| Protein automated matches [190159] (12 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186882] (61 PDB entries) |
| Domain d2yhfg_: 2yhf G: [198761] automated match to d2yhfi_ |
PDB Entry: 2yhf (more details), 1.9 Å
SCOPe Domain Sequences for d2yhfg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yhfg_ d.169.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mcpkdwefyqarcfflstsesswnesrdfckgkgstlaivntpeklkflqditdaekyfi
gliyhreekrwrwinnsvfngnvtnqnqnfncatigltktfdaascdisyrricekna
Timeline for d2yhfg_: