Lineage for d2yhfa_ (2yhf A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1682071Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1682072Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1682776Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1682777Protein automated matches [190159] (12 species)
    not a true protein
  7. 1682825Species Human (Homo sapiens) [TaxId:9606] [186882] (61 PDB entries)
  8. 1682924Domain d2yhfa_: 2yhf A: [198755]
    automated match to d2yhfi_

Details for d2yhfa_

PDB Entry: 2yhf (more details), 1.9 Å

PDB Description: 1.9 angstrom crystal structure of clec5a
PDB Compounds: (A:) c-type lectin domain family 5 member a

SCOPe Domain Sequences for d2yhfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yhfa_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mcpkdwefyqarcfflstsesswnesrdfckgkgstlaivntpeklkflqditdaekyfi
gliyhreekrwrwinnsvfngnvtnqnqnfncatigltktfdaascdisyrricekna

SCOPe Domain Coordinates for d2yhfa_:

Click to download the PDB-style file with coordinates for d2yhfa_.
(The format of our PDB-style files is described here.)

Timeline for d2yhfa_: