Lineage for d2y6pa_ (2y6p A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2899284Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2899285Protein automated matches [190951] (34 species)
    not a true protein
  7. 2899298Species Aquifex aeolicus [TaxId:63363] [196205] (1 PDB entry)
  8. 2899299Domain d2y6pa_: 2y6p A: [198674]
    automated match to d2y6pc_
    complexed with bme, ctp, ipa, mg

Details for d2y6pa_

PDB Entry: 2y6p (more details), 2.1 Å

PDB Description: evidence for a two-metal-ion-mechanism in the kdo- cytidylyltransferase kdsb
PDB Compounds: (A:) 3-deoxy-manno-octulosonate cytidylyltransferase

SCOPe Domain Sequences for d2y6pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y6pa_ c.68.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]}
rraviiparlgstrlkekplknllgkplirwvveglvktgervilatdservkevvedlc
evfltpsdlpsgsdrvlyvvrdldvdliinyqgdepfvyeediklifrelekgervvtla
rkdkeayerpedvkvvldregyalyfsrspipyfrkndtfyplkhvgiygfrketlmefg
amppskleqiegleqlrllengikikvlitenyyhgvdteedlkiveeklk

SCOPe Domain Coordinates for d2y6pa_:

Click to download the PDB-style file with coordinates for d2y6pa_.
(The format of our PDB-style files is described here.)

Timeline for d2y6pa_: