| Class b: All beta proteins [48724] (176 folds) |
| Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
| Family b.33.1.0: automated matches [191455] (1 protein) not a true family |
| Protein automated matches [190701] (10 species) not a true protein |
| Species Burkholderia xenovorans [TaxId:266265] [226023] (7 PDB entries) |
| Domain d2xrxc1: 2xrx C:18-179 [198640] Other proteins in same PDB: d2xrxa2, d2xrxb_, d2xrxc2, d2xrxd_, d2xrxe2, d2xrxf_, d2xrxg2, d2xrxh_, d2xrxi2, d2xrxj_, d2xrxk2, d2xrxl_, d2xrxm2, d2xrxn_, d2xrxo2, d2xrxp_, d2xrxq2, d2xrxr_, d2xrxs2, d2xrxt_, d2xrxu2, d2xrxv_, d2xrxw2, d2xrxx_ automated match to d1wqla1 complexed with bnl, fe2, fes |
PDB Entry: 2xrx (more details), 2.42 Å
SCOPe Domain Sequences for d2xrxc1:
Sequence, based on SEQRES records: (download)
>d2xrxc1 b.33.1.0 (C:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvq
>d2xrxc1 b.33.1.0 (C:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeafdkaewgplqarvatykglvfanwdvq
Timeline for d2xrxc1:
View in 3DDomains from other chains: (mouse over for more information) d2xrxa1, d2xrxa2, d2xrxb_, d2xrxd_, d2xrxe1, d2xrxe2, d2xrxf_, d2xrxg1, d2xrxg2, d2xrxh_, d2xrxi1, d2xrxi2, d2xrxj_, d2xrxk1, d2xrxk2, d2xrxl_, d2xrxm1, d2xrxm2, d2xrxn_, d2xrxo1, d2xrxo2, d2xrxp_, d2xrxq1, d2xrxq2, d2xrxr_, d2xrxs1, d2xrxs2, d2xrxt_, d2xrxu1, d2xrxu2, d2xrxv_, d2xrxw1, d2xrxw2, d2xrxx_ |