Lineage for d2xrxx_ (2xrx X:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1640316Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1640820Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1641078Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 1641134Protein automated matches [190223] (4 species)
    not a true protein
  7. 1641135Species Burkholderia xenovorans [TaxId:266265] [189543] (7 PDB entries)
  8. 1641189Domain d2xrxx_: 2xrx X: [170346]
    Other proteins in same PDB: d2xrxa1, d2xrxa2, d2xrxc1, d2xrxc2, d2xrxe1, d2xrxe2, d2xrxg1, d2xrxg2, d2xrxi1, d2xrxi2, d2xrxk1, d2xrxk2, d2xrxm1, d2xrxm2, d2xrxo1, d2xrxo2, d2xrxq1, d2xrxq2, d2xrxs1, d2xrxs2, d2xrxu1, d2xrxu2, d2xrxw1, d2xrxw2
    automated match to d1wqlb1
    complexed with bnl, fe2, fes

Details for d2xrxx_

PDB Entry: 2xrx (more details), 2.42 Å

PDB Description: crystal structure of biphenyl dioxygenase in complex with biphenyl from burkholderia xenovorans lb400
PDB Compounds: (X:) Biphenyl dioxygenase subunit beta

SCOPe Domain Sequences for d2xrxx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xrxx_ d.17.4.4 (X:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
ffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmir
egeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdt
fevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmf
f

SCOPe Domain Coordinates for d2xrxx_:

Click to download the PDB-style file with coordinates for d2xrxx_.
(The format of our PDB-style files is described here.)

Timeline for d2xrxx_: