Lineage for d2wona2 (2won A:430-558)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2885834Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 2885885Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)
  7. 2885895Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (104 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 2885937Domain d2wona2: 2won A:430-558 [198524]
    Other proteins in same PDB: d2wona1, d2wonb_
    automated match to d1c1ba1
    complexed with zze

Details for d2wona2

PDB Entry: 2won (more details), 2.8 Å

PDB Description: crystal structure of uk-453061 bound to hiv-1 reverse transcriptase (wild-type).
PDB Compounds: (A:) hiv-1 reverse transcriptase

SCOPe Domain Sequences for d2wona2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wona2 c.55.3.1 (A:430-558) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagirk

SCOPe Domain Coordinates for d2wona2:

Click to download the PDB-style file with coordinates for d2wona2.
(The format of our PDB-style files is described here.)

Timeline for d2wona2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wona1
View in 3D
Domains from other chains:
(mouse over for more information)
d2wonb_