Lineage for d2rf2a3 (2rf2 A:430-557)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2495032Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2495033Protein automated matches [190396] (40 species)
    not a true protein
  7. 2495100Species Hiv-1 m:b_hxb2r [TaxId:11706] [225268] (21 PDB entries)
  8. 2495104Domain d2rf2a3: 2rf2 A:430-557 [198340]
    Other proteins in same PDB: d2rf2a2, d2rf2b_
    automated match to d1bqna1
    protein/DNA complex; protein/RNA complex; complexed with mrx

Details for d2rf2a3

PDB Entry: 2rf2 (more details), 2.4 Å

PDB Description: HIV reverse transcriptase in complex with inhibitor 7e (NNRTI)
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.4) (p66 RT)

SCOPe Domain Sequences for d2rf2a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rf2a3 c.55.3.0 (A:430-557) automated matches {Hiv-1 m:b_hxb2r [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagir

SCOPe Domain Coordinates for d2rf2a3:

Click to download the PDB-style file with coordinates for d2rf2a3.
(The format of our PDB-style files is described here.)

Timeline for d2rf2a3:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rf2a2
View in 3D
Domains from other chains:
(mouse over for more information)
d2rf2b_