SCOPe 2.08: Domain d2rf2a3: 2rf2 A:430-557

Lineage for d2rf2a3 (2rf2 A:430-557)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Hiv-1 m:b_hxb2r [TaxId:11706] [225268] (21 PDB entries)

8. Domain d2rf2a3: 2rf2 A:430-557 [198340]
   Other proteins in same PDB: d2rf2a2, d2rf2b_
   automated match to d1bqna1
   protein/DNA complex; protein/RNA complex; complexed with mrx

Details for d2rf2a3

PDB Entry: 2rf2, 2.4 Å

PDB Description: HIV reverse transcriptase in complex with inhibitor 7e (NNRTI)

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.4) (p66 RT)

SCOPe Domain Sequences for d2rf2a3:

Sequence; same for both SEQRES and ATOM records:

>d2rf2a3 c.55.3.0 (A:430-557) automated matches {Hiv-1 m:b_hxb2r [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagir

Timeline for d2rf2a3:

• d2rf2a3 first appeared in SCOPe 2.03
  
• d2rf2a3 appears in SCOPe 2.07