Lineage for d2qwrb_ (2qwr B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303207Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303330Superfamily a.2.3: Chaperone J-domain [46565] (2 families) (S)
  5. 2303331Family a.2.3.1: Chaperone J-domain [46566] (7 proteins)
    Pfam PF00226
  6. 2303332Protein Auxilin J-domain [88969] (1 species)
  7. 2303333Species Cow (Bos taurus) [TaxId:9913] [88970] (7 PDB entries)
  8. 2303339Domain d2qwrb_: 2qwr B: [198318]
    Other proteins in same PDB: d2qwra1, d2qwra2
    automated match to d1nz6b_
    complexed with acy, anp, gol

Details for d2qwrb_

PDB Entry: 2qwr (more details), 2.21 Å

PDB Description: crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-394aa)r171c and bovine auxilin (810-910aa)d876c in the amppnp intact form
PDB Compounds: (B:) Putative tyrosine-protein phosphatase auxilin

SCOPe Domain Sequences for d2qwrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qwrb_ a.2.3.1 (B:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]}
dpeklkilewiegkernirallstmhtvlwagetkwkpvgmadlvtpeqvkkvyrkavlv
vhpckatgqpyeqyakmifmelndawsefenq

SCOPe Domain Coordinates for d2qwrb_:

Click to download the PDB-style file with coordinates for d2qwrb_.
(The format of our PDB-style files is described here.)

Timeline for d2qwrb_: