![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.3: Chaperone J-domain [46565] (2 families) ![]() |
![]() | Family a.2.3.1: Chaperone J-domain [46566] (8 proteins) Pfam PF00226 |
![]() | Protein automated matches [226960] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [225388] (4 PDB entries) |
![]() | Domain d2qwrb_: 2qwr B: [198318] Other proteins in same PDB: d2qwra1, d2qwra2 automated match to d1nz6b_ complexed with acy, anp, gol |
PDB Entry: 2qwr (more details), 2.21 Å
SCOPe Domain Sequences for d2qwrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qwrb_ a.2.3.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]} dpeklkilewiegkernirallstmhtvlwagetkwkpvgmadlvtpeqvkkvyrkavlv vhpckatgqpyeqyakmifmelndawsefenq
Timeline for d2qwrb_: