SCOPe 2.03: Domain d2qwrb_: 2qwr B:

Lineage for d2qwrb_ (2qwr B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.3: Chaperone J-domain [46565] (2 families)

5. Family a.2.3.1: Chaperone J-domain [46566] (8 proteins)
   Pfam PF00226

6. Protein automated matches [226960] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [225388] (4 PDB entries)

8. Domain d2qwrb_: 2qwr B: [198318]
   Other proteins in same PDB: d2qwra1, d2qwra2
   automated match to d1nz6b_
   complexed with acy, anp, gol

Details for d2qwrb_

PDB Entry: 2qwr, 2.21 Å

PDB Description: crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-394aa)r171c and bovine auxilin (810-910aa)d876c in the amppnp intact form

PDB Compounds: (B:) Putative tyrosine-protein phosphatase auxilin

SCOPe Domain Sequences for d2qwrb_:

Sequence; same for both SEQRES and ATOM records:

>d2qwrb_ a.2.3.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dpeklkilewiegkernirallstmhtvlwagetkwkpvgmadlvtpeqvkkvyrkavlv
vhpckatgqpyeqyakmifmelndawsefenq

Timeline for d2qwrb_:

• d2qwrb_ is new in SCOPe 2.03-stable
  
• d2qwrb_ appears in SCOPe 2.04
  
• d2qwrb_ appears in the current release, SCOPe 2.08