![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
![]() | Species Fv MEZ (human) IgM, kappa L chain [48763] (1 PDB entry) |
![]() | Domain d1dqlh_: 1dql H: [19829] |
PDB Entry: 1dql (more details), 2.6 Å
SCOP Domain Sequences for d1dqlh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dqlh_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Fv MEZ (human) IgM, kappa L chain} evqlvesggglvqpggslrlscaasgftfssyamhwvrqapgkglewvavissdggnkyy tdsvkgrftisrndskntlylqmnslrtedtavfycargnppyssgwgggdywgqgtmvt vss
Timeline for d1dqlh_: