Lineage for d1dqlh_ (1dql H:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7913Species Fv MEZ (human) IgM, kappa L chain [48763] (1 PDB entry)
  8. 7914Domain d1dqlh_: 1dql H: [19829]

Details for d1dqlh_

PDB Entry: 1dql (more details), 2.6 Å

PDB Description: crystal structure of an unliganded (native) fv from a human igm anti- peptide antibody

SCOP Domain Sequences for d1dqlh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqlh_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Fv MEZ (human) IgM, kappa L chain}
evqlvesggglvqpggslrlscaasgftfssyamhwvrqapgkglewvavissdggnkyy
tdsvkgrftisrndskntlylqmnslrtedtavfycargnppyssgwgggdywgqgtmvt
vss

SCOP Domain Coordinates for d1dqlh_:

Click to download the PDB-style file with coordinates for d1dqlh_.
(The format of our PDB-style files is described here.)

Timeline for d1dqlh_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dqll_