Lineage for d2p9ub1 (2p9u B:147-357)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2137194Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2137195Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2137403Protein Actin-related protein 2, Arp2 [69530] (1 species)
    part of Arp2/3 complex
  7. 2137404Species Cow (Bos taurus) [TaxId:9913] [69531] (14 PDB entries)
    Uniprot P61160 143-350 # 100% sequence identity
  8. 2137412Domain d2p9ub1: 2p9u B:147-357 [198249]
    Other proteins in same PDB: d2p9ua1, d2p9ua2, d2p9uc_, d2p9ud1, d2p9ud2, d2p9ue_, d2p9uf_, d2p9ug_
    automated match to d1u2vb1
    complexed with anp, ca

Details for d2p9ub1

PDB Entry: 2p9u (more details), 2.75 Å

PDB Description: crystal structure of bovine arp2/3 complex co-crystallized with amp- pnp and calcium
PDB Compounds: (B:) actin-like protein 2

SCOPe Domain Sequences for d2p9ub1:

Sequence, based on SEQRES records: (download)

>d2p9ub1 c.55.1.1 (B:147-357) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]}
yaqglltgvvvdsgdgvthicpvyegfslphltrrldiagrditrylikllllrgyafnh
sadfetvrmikeklcyvgynieqeqklalettvlvesytlpdgriikvggerfeapealf
qphlinvegvgvaellfntiqaadidtrsefykhivlsggstmypglpsrlerelkqlyl
ervlkgdveklskfkiriedpprrkhmvflg

Sequence, based on observed residues (ATOM records): (download)

>d2p9ub1 c.55.1.1 (B:147-357) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]}
yqglltgvvvdsgdgvthicpvyegfslphltrrldiagrditrylikllllrgyafnhs
adfetvrmikeklcyvgynieqeqklalettvlvesytlpdgriikvggerfeapealfq
phlinvegvgvaellfntiqaadidtrsefykhivlsggstmypglpsrlerelkqlyle
rvlkgdveklskfkiriedpprrkhmvflg

SCOPe Domain Coordinates for d2p9ub1:

Click to download the PDB-style file with coordinates for d2p9ub1.
(The format of our PDB-style files is described here.)

Timeline for d2p9ub1: