SCOPe 2.05: Domain d2p9ub1: 2p9u B:147-357

Lineage for d2p9ub1 (2p9u B:147-357)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin-related protein 2, Arp2 [69530] (1 species)
   part of Arp2/3 complex

7. Species Cow (Bos taurus) [TaxId:9913] [69531] (14 PDB entries)
   Uniprot P61160 143-350 # 100% sequence identity

8. Domain d2p9ub1: 2p9u B:147-357 [198249]
   Other proteins in same PDB: d2p9ua1, d2p9ua2, d2p9uc_, d2p9ud1, d2p9ud2, d2p9ue_, d2p9uf_, d2p9ug_
   automated match to d1u2vb1
   complexed with anp, ca

Details for d2p9ub1

PDB Entry: 2p9u, 2.75 Å

PDB Description: crystal structure of bovine arp2/3 complex co-crystallized with amp- pnp and calcium

PDB Compounds: (B:) actin-like protein 2

SCOPe Domain Sequences for d2p9ub1:

Sequence, based on SEQRES records:

>d2p9ub1 c.55.1.1 (B:147-357) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]}
yaqglltgvvvdsgdgvthicpvyegfslphltrrldiagrditrylikllllrgyafnh
sadfetvrmikeklcyvgynieqeqklalettvlvesytlpdgriikvggerfeapealf
qphlinvegvgvaellfntiqaadidtrsefykhivlsggstmypglpsrlerelkqlyl
ervlkgdveklskfkiriedpprrkhmvflg

Sequence, based on observed residues (ATOM records):

>d2p9ub1 c.55.1.1 (B:147-357) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]}
yqglltgvvvdsgdgvthicpvyegfslphltrrldiagrditrylikllllrgyafnhs
adfetvrmikeklcyvgynieqeqklalettvlvesytlpdgriikvggerfeapealfq
phlinvegvgvaellfntiqaadidtrsefykhivlsggstmypglpsrlerelkqlyle
rvlkgdveklskfkiriedpprrkhmvflg

Timeline for d2p9ub1:

• d2p9ub1 first appeared in SCOPe 2.03
  
• d2p9ub1 appears in SCOPe 2.04
  
• d2p9ub1 appears in SCOPe 2.06
  
• d2p9ub1 appears in the current release, SCOPe 2.08