SCOPe 2.08: Domain d2p7ta1: 2p7t A:6-118

Lineage for d2p7ta1 (2p7t A:6-118)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (181 PDB entries)
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor

8. Domain d2p7ta1: 2p7t A:6-118 [198235]
   Other proteins in same PDB: d2p7ta2, d2p7ta3, d2p7tb1, d2p7tb2, d2p7tc2, d2p7tc3
   automated match to d1r3jb1
   complexed with 1em, f09, k; mutant

Details for d2p7ta1

PDB Entry: 2p7t, 2.05 Å

PDB Description: crystal structure of kcsa mutant

PDB Compounds: (A:) fab-a

SCOPe Domain Sequences for d2p7ta1:

Sequence; same for both SEQRES and ATOM records:

>d2p7ta1 b.1.1.1 (A:6-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygranynekiq
kkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvss

Timeline for d2p7ta1:

• d2p7ta1 first appeared in SCOPe 2.03
  
• d2p7ta1 appears in SCOPe 2.07