PDB entry 2p7t

View 2p7t on RCSB PDB site
Description: Crystal Structure of KcsA mutant
Class: membrane protein
Keywords: KcsA, MEMBRANE PROTEIN
Deposited on 2007-03-20, released 2007-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.219
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fab-a
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2P7T (0-218)
    Domains in SCOPe 2.07: d2p7ta1, d2p7ta2, d2p7ta3
  • Chain 'B':
    Compound: fab-b
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2P7T (0-211)
    Domains in SCOPe 2.07: d2p7tb1, d2p7tb2
  • Chain 'C':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Gene: kcsA, skc1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (0-81)
      • engineered (49)
      • engineered (68)
    Domains in SCOPe 2.07: d2p7tc_
  • Heterogens: K, 1EM, F09, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p7tA (A:)
    qvqlqqpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygrany
    nekiqkkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssswpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p7tB (B:)
    dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
    rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p7tC (C:)
    salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvstattvgygdl
    ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh