SCOPe 2.08: Domain d2p7tc2: 2p7t C:22-116

Lineage for d2p7tc2 (2p7t C:22-116)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families)
   Pfam PF00520

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Potassium channel protein [56901] (3 species)

7. Species Streptomyces lividans [TaxId:1916] [161074] (36 PDB entries)

8. Domain d2p7tc2: 2p7t C:22-116 [149291]
   Other proteins in same PDB: d2p7ta1, d2p7ta2, d2p7ta3, d2p7tb1, d2p7tb2, d2p7tc3
   automated match to d1k4cc_
   complexed with 1em, f09, k; mutant

Details for d2p7tc2

PDB Entry: 2p7t, 2.05 Å

PDB Description: crystal structure of kcsa mutant

PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2p7tc2:

Sequence; same for both SEQRES and ATOM records:

>d2p7tc2 f.14.1.1 (C:22-116) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvstattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvg

Timeline for d2p7tc2:

• d2p7tc2 first appeared in SCOP 1.75, called d2p7tc1
  
• d2p7tc2 was called d2p7tc_ in SCOPe 2.07