Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
Species Fab B13I2 (mouse), kappa L chain [48760] (2 PDB entries) |
Domain d1igfl1: 1igf L:1-107 [19812] Other proteins in same PDB: d1igfh2, d1igfj2, d1igfl2, d1igfm2 |
PDB Entry: 1igf (more details), 2.8 Å
SCOP Domain Sequences for d1igfl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igfl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab B13I2 (mouse), kappa L chain} dvlmtqtplslpvslgdqasiscrsnqtillsdgdtylewylqkpgqspklliykvsnrf sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleik
Timeline for d1igfl1: