Lineage for d1igfl1 (1igf L:1-107)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7518Species Fab B13I2 (mouse), kappa L chain [48760] (2 PDB entries)
  8. 7521Domain d1igfl1: 1igf L:1-107 [19812]
    Other proteins in same PDB: d1igfh2, d1igfj2, d1igfl2, d1igfm2

Details for d1igfl1

PDB Entry: 1igf (more details), 2.8 Å

PDB Description: crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 angstroms

SCOP Domain Sequences for d1igfl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igfl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab B13I2 (mouse), kappa L chain}
dvlmtqtplslpvslgdqasiscrsnqtillsdgdtylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleik

SCOP Domain Coordinates for d1igfl1:

Click to download the PDB-style file with coordinates for d1igfl1.
(The format of our PDB-style files is described here.)

Timeline for d1igfl1: