Lineage for d2ghfa3 (2ghf A:96-153)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1964751Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 1964752Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 1964753Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 1964972Protein Zinc fingers and homeoboxes protein 1, ZHX1 [144141] (1 species)
  7. 1964973Species Human (Homo sapiens) [TaxId:9606] [144142] (1 PDB entry)
    Uniprot Q9UKY1 60-95! Uniprot Q9UKY1 96-153
  8. 1964974Domain d2ghfa3: 2ghf A:96-153 [197952]
    ZnF 2 with extra C-terminal beta-hairpin
    complexed with zn

Details for d2ghfa3

PDB Entry: 2ghf (more details)

PDB Description: solution structure of the complete zinc-finger region of human zinc- fingers and homeoboxes 1 (zhx1)
PDB Compounds: (A:) Zinc fingers and homeoboxes protein 1

SCOPe Domain Sequences for d2ghfa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ghfa3 g.37.1.1 (A:96-153) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]}
vvlnssyvcvecnfltkrydalsehnlkyhpgeenfkltmvkrnnqtifeqtindltf

SCOPe Domain Coordinates for d2ghfa3:

Click to download the PDB-style file with coordinates for d2ghfa3.
(The format of our PDB-style files is described here.)

Timeline for d2ghfa3:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ghfa4