SCOPe 2.04: Domain d2ghfa3: 2ghf A:96-153

Lineage for d2ghfa3 (2ghf A:96-153)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
   simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC

4. Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families)

5. Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)

6. Protein Zinc fingers and homeoboxes protein 1, ZHX1 [144141] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [144142] (1 PDB entry)
   Uniprot Q9UKY1 60-95! Uniprot Q9UKY1 96-153

8. Domain d2ghfa3: 2ghf A:96-153 [197952]
   ZnF 2 with extra C-terminal beta-hairpin
   complexed with zn

Details for d2ghfa3

PDB Entry: 2ghf

PDB Description: solution structure of the complete zinc-finger region of human zinc- fingers and homeoboxes 1 (zhx1)

PDB Compounds: (A:) Zinc fingers and homeoboxes protein 1

SCOPe Domain Sequences for d2ghfa3:

Sequence; same for both SEQRES and ATOM records:

>d2ghfa3 g.37.1.1 (A:96-153) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]}
vvlnssyvcvecnfltkrydalsehnlkyhpgeenfkltmvkrnnqtifeqtindltf

Timeline for d2ghfa3:

• d2ghfa3 first appeared in SCOPe 2.03
  
• d2ghfa3 appears in SCOPe 2.05
  
• d2ghfa3 appears in the current release, SCOPe 2.08