Lineage for d1z3p.1 (1z3p S:,E:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [54079] (210 PDB entries)
  8. Domain d1z3p.1: 1z3p S:,E: [197685]
    automatically matched to d1rbc__
    complexed with so4; mutant

Details for d1z3p.1

PDB Entry: 1z3p (more details), 2 Å

PDB Description: X-Ray crystal structure of a mutant Ribonuclease S (M13Nva)
PDB Compounds: (E:) Ribonuclease pancreatic, S-Protein, (S:) Ribonuclease pancreatic, S-Peptide

SCOPe Domain Sequences for d1z3p.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1z3p.1 d.5.1.1 (S:,E:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhvdsXsssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknva
ckngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfdasv

SCOPe Domain Coordinates for d1z3p.1 are not available.

Timeline for d1z3p.1: