PDB entry 1z3p

View 1z3p on RCSB PDB site
Description: X-Ray crystal structure of a mutant Ribonuclease S (M13Nva)
Class: Hydrolase
Keywords: RNase S mutant (M13Nva), S-Peptide, S-Protein, cavity, hydrolase
Deposited on 2005-03-14, released 2005-03-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Ribonuclease pancreatic, S-Protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1z3p.1
  • Chain 'S':
    Compound: Ribonuclease pancreatic, S-Peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61823 (0-14)
      • engineered (12)
    Domains in SCOPe 2.08: d1z3p.1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z3pE (E:)
    sssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystms
    itdcretgsskypncaykttqankhiivacegnpyvpvhfdasv
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z3pS (S:)
    ketaaakferqhvds