Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.19: Tandem AAA-ATPase domain [81268] (27 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
Protein putative ATP-dependent RNA helicase PF2015 [142308] (1 species) separate structures of other domains are known: the middle nuclease domain (89718) and the C-terminal RuvA-like HhH domain (PDB 1x2i) |
Species Pyrococcus furiosus [TaxId:2261] [142309] (1 PDB entry) Uniprot Q8TZH8 2-201! Uniprot Q8TZH8 202-487 |
Domain d1wp9b1: 1wp9 B:1-200 [197621] automated match to d1wp9a1 complexed with po4 |
PDB Entry: 1wp9 (more details), 2.9 Å
SCOPe Domain Sequences for d1wp9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wp9b1 c.37.1.19 (B:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} mvlrrdliqpriyqeviyakcketnclivlptglgktliammiaeyrltkyggkvlmlap tkplvlqhaesfrrlfnlppekivaltgekspeerskawarakvivatpqtiendllagr isledvslivfdeahravgnyayvfiareykrqaknplvigltaspgstpekimevinnl giehieyrsenspdvrpyvk
Timeline for d1wp9b1: