SCOPe 2.08: Domain d1wp9b1: 1wp9 B:1-200

Lineage for d1wp9b1 (1wp9 B:1-200)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein putative ATP-dependent RNA helicase PF2015, N-terminal domain [419076] (1 species)
   separate structures of other domains are known: the middle nuclease domain (89718) and the C-terminal RuvA-like HhH domain (PDB 1x2i)

7. Species Pyrococcus furiosus [TaxId:2261] [419576] (1 PDB entry)

8. Domain d1wp9b1: 1wp9 B:1-200 [197621]
   Other proteins in same PDB: d1wp9a2, d1wp9b2, d1wp9c2, d1wp9d2, d1wp9e2, d1wp9f2
   automated match to d1wp9a1
   complexed with po4

Details for d1wp9b1

PDB Entry: 1wp9, 2.9 Å

PDB Description: crystal structure of pyrococcus furiosus hef helicase domain

PDB Compounds: (B:) ATP-dependent RNA helicase, putative

SCOPe Domain Sequences for d1wp9b1:

Sequence; same for both SEQRES and ATOM records:

>d1wp9b1 c.37.1.19 (B:1-200) putative ATP-dependent RNA helicase PF2015, N-terminal domain {Pyrococcus furiosus [TaxId: 2261]}
mvlrrdliqpriyqeviyakcketnclivlptglgktliammiaeyrltkyggkvlmlap
tkplvlqhaesfrrlfnlppekivaltgekspeerskawarakvivatpqtiendllagr
isledvslivfdeahravgnyayvfiareykrqaknplvigltaspgstpekimevinnl
giehieyrsenspdvrpyvk

Timeline for d1wp9b1:

• d1wp9b1 first appeared in SCOPe 2.03
  
• d1wp9b1 appears in SCOPe 2.07