SCOP 1.61: Domain d1a7bc_: 1a7b C:

Lineage for d1a7bc_ (1a7b C:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein CD2, first domain [48740] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [48742] (5 PDB entries)

8. Domain d1a7bc_: 1a7b C: [19756]

Details for d1a7bc_

PDB Entry: 1a7b, 3.1 Å

PDB Description: engineering a misfolded form of cd2

SCOP Domain Sequences for d1a7bc_:

Sequence; same for both SEQRES and ATOM records:

>d1a7bc_ b.1.1.1 (C:) CD2, first domain {Rat (Rattus norvegicus)}
tvwgalghginlnipnfqmtddidevrwergstlvaefkrkpflksgafeilangdlkik
nltrddsgtynvtvystngtrildkaldlrile

Timeline for d1a7bc_:

• d1a7bc_ first appeared (with stable ids) in SCOP 1.55
  
• d1a7bc_ appears in SCOP 1.59
  
• d1a7bc_ appears in SCOP 1.63
  
• d1a7bc_ appears in the current release, SCOPe 2.08