Lineage for d1a7bc_ (1a7b C:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 6996Protein CD2, first domain [48740] (2 species)
  7. 7003Species Rat (Rattus norvegicus) [TaxId:10116] [48742] (5 PDB entries)
  8. 7014Domain d1a7bc_: 1a7b C: [19756]

Details for d1a7bc_

PDB Entry: 1a7b (more details), 3.1 Å

PDB Description: engineering a misfolded form of cd2

SCOP Domain Sequences for d1a7bc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a7bc_ b.1.1.1 (C:) CD2, first domain {Rat (Rattus norvegicus)}
tvwgalghginlnipnfqmtddidevrwergstlvaefkrkpflksgafeilangdlkik
nltrddsgtynvtvystngtrildkaldlrile

SCOP Domain Coordinates for d1a7bc_:

Click to download the PDB-style file with coordinates for d1a7bc_.
(The format of our PDB-style files is described here.)

Timeline for d1a7bc_: