SCOPe 2.08: Domain d1puub3: 1puu B:1-138

Lineage for d1puub3 (1puu B:1-138)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
   duplication: consists of two domains of this fold

7. Species European mistletoe (Viscum album) [TaxId:3972] [50375] (12 PDB entries)
   different sequence variants
   Uniprot Q6ITZ3 266-520; Uniprot P81446 269-531 # 91% sequence identity

8. Domain d1puub3: 1puu B:1-138 [197465]
   Other proteins in same PDB: d1puua_
   complexed with cl, dio, gol, nag, so4

Details for d1puub3

PDB Entry: 1puu, 2.3 Å

PDB Description: mistletoe lectin i in complex with lactose

PDB Compounds: (B:) lectin I B chain

SCOPe Domain Sequences for d1puub3:

Sequence; same for both SEQRES and ATOM records:

>d1puub3 b.42.2.1 (B:1-138) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]}
ddvtcsasepivrivgrngmtvdvrdddfqdgnqiqlwpsksnndpnqlwtikkdgtirs
ngsclttygytagvyvmifdcntavreatiwqiwgngtiinprsnlvlaassgikgttlt
vqtldytlgqgwlagndt

Timeline for d1puub3:

• d1puub3 first appeared in SCOPe 2.03
  
• d1puub3 appears in SCOPe 2.07