Lineage for d1cdba_ (1cdb A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 929364Protein CD2, first domain [48740] (2 species)
  7. 929365Species Human (Homo sapiens) [TaxId:9606] [48741] (4 PDB entries)
  8. 929369Domain d1cdba_: 1cdb A: [19744]

Details for d1cdba_

PDB Entry: 1cdb (more details)

PDB Description: structure of the glycosylated adhesion domain of human t lymphocyte glycoprotein cd2
PDB Compounds: (A:) cd2

SCOPe Domain Sequences for d1cdba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cdba_ b.1.1.1 (A:) CD2, first domain {Human (Homo sapiens) [TaxId: 9606]}
keitnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdty
klfkngtlkikhlktddqdiykvsiydtkgknvlekifdlkiqer

SCOPe Domain Coordinates for d1cdba_:

Click to download the PDB-style file with coordinates for d1cdba_.
(The format of our PDB-style files is described here.)

Timeline for d1cdba_: