SCOPe 2.08: Domain d1cdba_: 1cdb A:

Lineage for d1cdba_ (1cdb A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein CD2, first domain [48740] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48741] (4 PDB entries)

8. Domain d1cdba_: 1cdb A: [19744]

Details for d1cdba_

PDB Entry: 1cdb

PDB Description: structure of the glycosylated adhesion domain of human t lymphocyte glycoprotein cd2

PDB Compounds: (A:) cd2

SCOPe Domain Sequences for d1cdba_:

Sequence; same for both SEQRES and ATOM records:

>d1cdba_ b.1.1.1 (A:) CD2, first domain {Human (Homo sapiens) [TaxId: 9606]}
keitnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdty
klfkngtlkikhlktddqdiykvsiydtkgknvlekifdlkiqer

Timeline for d1cdba_:

• d1cdba_ first appeared (with stable ids) in SCOP 1.55, called d1cdb__
  
• d1cdba_ appears in SCOPe 2.07