![]() | Class g: Small proteins [56992] (91 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) ![]() |
![]() | Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins) |
![]() | Protein automated matches [197331] (4 species) not a true protein |
![]() | Species Leiurus quinquestriatus [TaxId:6884] [197332] (1 PDB entry) |
![]() | Domain d4jtdy_: 4jtd Y: [197333] Other proteins in same PDB: d4jtda_, d4jtdg_ automated match to d2crda_ complexed with k, nap, pgw; mutant |
PDB Entry: 4jtd (more details), 2.54 Å
SCOPe Domain Sequences for d4jtdy_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jtdy_ g.3.7.2 (Y:) automated matches {Leiurus quinquestriatus [TaxId: 6884]} eftnvscttskecwsvcqrlhntsrgmcmnkkcrcys
Timeline for d4jtdy_: