Lineage for d4jtdy_ (4jtd Y:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1960255Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1960727Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) (S)
  5. 1960843Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)
  6. 1960968Protein automated matches [197331] (4 species)
    not a true protein
  7. 1960971Species Leiurus quinquestriatus [TaxId:6884] [197332] (1 PDB entry)
  8. 1960972Domain d4jtdy_: 4jtd Y: [197333]
    Other proteins in same PDB: d4jtda_, d4jtdg_
    automated match to d2crda_
    complexed with k, nap, pgw; mutant

Details for d4jtdy_

PDB Entry: 4jtd (more details), 2.54 Å

PDB Description: crystal structure of kv1.2-2.1 paddle chimera channel in complex with lys27met mutant of charybdotoxin
PDB Compounds: (Y:) Potassium channel toxin alpha-KTx 1.1

SCOPe Domain Sequences for d4jtdy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jtdy_ g.3.7.2 (Y:) automated matches {Leiurus quinquestriatus [TaxId: 6884]}
eftnvscttskecwsvcqrlhntsrgmcmnkkcrcys

SCOPe Domain Coordinates for d4jtdy_:

Click to download the PDB-style file with coordinates for d4jtdy_.
(The format of our PDB-style files is described here.)

Timeline for d4jtdy_: